DPCstruct | MC16533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 87 ± 7 aa |
| Standard deviation of domain lengths | 6.86 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 27.32 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | CL0136- CL0057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A510JZ42 | 1-83 | MATVTARVDENVKKEAETLFKKMGLNMSTAMNLFLKKCILEQGIPFELKVPNGETRKVLDEVEKGVGLSKTFDSIDELTEDLE |
| A0A2M7KUG3 | 102-185 | KSAVVTARVDPKLKHEAERIFAEIGLTTSQAVALFLKQVGLRNGLPFSVRVPVPNDTTRVALDDARERRDLATYETTDSLFEDL |
| A0A1W9T9A3 | 1-85 | None |
| R5FQB4 | 1-84 | None |
| A0A0Q9YBZ9 | 8-95 | None |
| C0E9R1 | 27-119 | None |
| K2C3C4 | 1-97 | None |
| A0A838T265 | 9-97 | None |
| A0A7U7G7G4 | 1-85 | None |
| A0A7W1BI26 | 1-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.