DPCstruct | MC16532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 375 ± 56 aa |
| Standard deviation of domain lengths | 55.58 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 12.92 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | PF08455- PF04434 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G4G764 | 3-356 | DSLVISLVQHPSFGYMLQPLFASFCPETEVYSITEMARADSPTFQTLTEEEQEIVKLAERYSGKNLMRAYSNEDNEVEFLRKVTAST… |
| A0A6I6G647 | 10-394 | VKTVLLLQPMRLLHRHPVLQLLQVSKKDNGMVEMEELPVMQAIVTQHLKGLDAEARKALMMVSESALQKEKLLIEKRFELQRTATDW… |
| A0A1Y6CDP5 | 111-540 | None |
| A0A2T2VF47 | 318-591 | None |
| A0A8A6BHY8 | 208-573 | None |
| J9G538 | 52-344 | None |
| A0A449BBU7 | 465-943 | None |
| Q1NQJ7 | 2-352 | None |
| A0A060UTZ2 | 1-357 | None |
| A0A375CSM4 | 82-506 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.