DPCstruct | MC16530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 174 ± 19 aa |
| Standard deviation of domain lengths | 18.72 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2JJI2 | 1-140 | MAKIDWVLSDVEQPATKTISGSDRLGYNVSCQQNCAHIELGDNPVVAGQQWVSGKYQSVEGGHGFLSGMFNGVEPTGRHPFGPGFKV… |
| A0A1Z4M2T1 | 82-246 | VPVEELRLPESFSPGLAIVDNYWSSVEESNPSIPTNQYVSGRVTCNGQNKPVAPKSGQSLSYLELAGSGYHGKRWVSGKQMVDGGCG… |
| A0A351LCM2 | 230-386 | None |
| A0A6M0RER0 | 219-423 | None |
| A0A2T1LRA4 | 7-192 | None |
| A0A2T1LVQ2 | 210-435 | None |
| A0A6P0WVH0 | 240-415 | None |
| E0UMN4 | 219-397 | None |
| A0A846EBM0 | 153-317 | None |
| A0A841VDB7 | 5-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.