DPCstruct | MC16525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 63 ± 3 aa |
| Standard deviation of domain lengths | 3.05 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 48.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0526 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z4GB05 | 1-63 | MSELTDALDRVVNWLQRHKPLYASALQTGLSDEEIEEKVKDLPFRLTREVYELYQWRNGMIDE |
| A0A1Z4LIN0 | 1-68 | MSALTEALKRFEHWLWNNHPKRANSLPSGLTSEEINYMAQSLPFSLSEEIKELYQWSNGCSTGLVTLS |
| K9R7Y2 | 1-62 | None |
| A0A6N2JTS4 | 1-61 | None |
| A0A3S1D5H3 | 111-168 | None |
| A0A3S1AA70 | 20-81 | None |
| A0A563W450 | 1-65 | None |
| A0A1L9QPE2 | 152-220 | None |
| A0A1Z4FXW8 | 40-99 | None |
| A0A1Z4FR02 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.