DPCstruct | MC16523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 8.93 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N4CR35 | 310-388 | YASSGAYLDRMGHYCKGCHYDVKARSGDTSCPFNSLYWHFLWRNRDKLGNNPRLALPYANWDGQTEVQQQATLTTAAHH |
| A0A846G129 | 1-83 | YIATGKYIDRMSNYCRDCKRDPGEAVGEKACPFTTLYWDYLMRHEDKLRKNQRMSLQVRNLGRLSEERKQAIRKQARTIRKNP |
| A0A6F8YEG5 | 225-323 | None |
| A0A433W3N3 | 655-746 | None |
| A0A259M5A0 | 613-702 | None |
| B1XVL7 | 50-130 | None |
| A0A4Q4XDT2 | 419-506 | None |
| A0A7V8AYK1 | 54-132 | None |
| A0A090QBY0 | 1-94 | None |
| A0A0L8LDF0 | 196-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.