DPCstruct | MC16521
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 172 ± 32 aa |
| Standard deviation of domain lengths | 31.58 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846FVR6 | 3-197 | GFLPTPQQNCPDYCSGKAELLIETDDPGNPRDYIDGQIYTLSYTLQGQINSQQHMLDAIYILLFDGYQIPEKPTWIDHIQPIFQQFG… |
| A0A3N1DD92 | 398-537 | PVSLPEEVVTDAQGRARVTLTGTDPGNPRKVIDGALAEVAYGPLHRKGEPDGKLSVRVFDAYRAPERPTWLRDVRPIFQQYANLYPV… |
| A0A2U1WVA8 | 1-202 | None |
| A0A850BGP8 | 1-219 | None |
| A0A7D9LIS8 | 694-856 | None |
| A0A3N5FWN0 | 227-369 | None |
| A0A7D9D8L5 | 82-229 | None |
| A0A1X7V0E2 | 1-170 | None |
| A0A1S3JJ99 | 485-606 | None |
| C3Z398 | 374-547 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.