DPCstruct | MC1652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 179 ± 25 aa |
| Standard deviation of domain lengths | 25.02 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 16.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7MDL0 | 150-313 | LALNAHLWGPPHGIPLSTFSHDQKAMAKISKTPVPTHLRIRALISPSSPSTLLLHTSFAIILPSFTTTSKNTLKHLWPLLPHTLTGH… |
| S3D6H3 | 14-178 | NFLSRLSCESKLLNTHGYSGQLNAKTKIRDGVLLFRDQVVLLLPASKPYPVARYISGGIFRMCCHHDFSDYKNFYKAGVSIPRSDRV… |
| A0A507QT09 | 74-262 | None |
| A0A135TG68 | 341-509 | None |
| A0A2T4BKV6 | 81-233 | None |
| A0A093X063 | 51-230 | None |
| A0A0G4MCB3 | 936-1086 | None |
| A0A3M7DHJ4 | 625-841 | None |
| A0A0C3DDX2 | 225-450 | None |
| A0A2J6TWQ3 | 363-543 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.