DPCstruct | MC16519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 151 ± 16 aa |
| Standard deviation of domain lengths | 15.81 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846FP95 | 639-778 | ITETMSAERVIIHYGPFSPSFRMKDLATFVKTQQVPGTWKMYLGVTDVDAQNLWTFLTQGLNINFLFLDEFLNSPAGEHLLMELGQV… |
| G5J055 | 1-125 | MESLEIYAEEGRITKEFAFFASQFDEKTLTELRETLRKRHKINGVKFSRLLKTPLMEDLLKSMGEIFSTHPNHNGFYAIRGALISAA… |
| A0A1C0VG31 | 48-198 | None |
| A0A7T5E707 | 8-139 | None |
| A0A6M0RSN5 | 207-354 | None |
| A0A2T1LR62 | 24-181 | None |
| A0A235IGZ7 | 24-177 | None |
| A0A7G8D540 | 4-136 | None |
| B0C903 | 13-193 | None |
| A0A433VYM1 | 1-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.