DPCstruct | MC16517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 145 ± 11 aa |
| Standard deviation of domain lengths | 11.21 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 18.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7I9G9 | 259-421 | LLSAQVQGRLKGIASYKEALETISIDFPDTEESKIAKAHLEQLTTANEEFLPHEKTKTWKLIFYGISHEDLTKAKSQLSEKIENISE… |
| A0A846F8W7 | 1-158 | MKKSSHLFFFLLLLIIGACQSNEEPLNLAPVFKEQVDSLHYVLVRVKPIAMTDNVEDTNSATNEVQQLREDLNALVKLDEAAKLRVS… |
| R5M761 | 261-394 | None |
| A0A7K3XEY3 | 743-907 | None |
| D3ICE2 | 791-918 | None |
| A0A6M1P022 | 537-687 | None |
| A0A0R2S6Y0 | 4-133 | None |
| A0A369QRR1 | 854-998 | None |
| A0A3C1BID6 | 95-232 | None |
| A0A1F3LPR1 | 943-1069 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.