DPCstruct | MC16514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 160 ± 18 aa |
| Standard deviation of domain lengths | 17.73 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F5UMT1 | 1-157 | MAWVFSLSAECGTKQSEAQQFAQYFNKIFCVLSNGRVSQCRAEIFQDIEENWWCRVCPSGISEIGINTPESAYLMTEIGRFLYLRLR… |
| A0A0F6W9C9 | 1-152 | MAIYYNLAAFVGARDEAEAFVAHFHGRTIPIEHGDLVLDITLRETPQGWLVGLWPVGMSYGTCDDARLVAPEAREAAARWFERELRG… |
| A0A7W5FHG7 | 1-128 | None |
| A0A6F8XN35 | 1-171 | None |
| A0A355GHW1 | 1-172 | None |
| A1ZPN2 | 1-152 | None |
| A0A317KQT8 | 87-261 | None |
| A0A7W1V7D6 | 1-130 | None |
| A0A3D9P3P0 | 1-187 | None |
| K9YQ73 | 1-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.