DPCstruct | MC16511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 281 ± 49 aa |
| Standard deviation of domain lengths | 49.16 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03497 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A110BF64 | 3-273 | GFIAVDQSLSKLEGSDKIGASNQKVQECLKDRYAVSGPLEISTERLTYLINEGVLQKQGDTLYTTGPSGTKYEFSVCANKDNGMLAI… |
| A0A5C5WEP1 | 1-263 | MGRKSASGCGMNSAHQKIFFQVARSLKVWILVRATNPESLQFIGPGYPDIVPKPLLCKAKTAETGPHAGLVVCPMMVPDSFSVARFD… |
| A0A0S2F6F6 | 13-283 | None |
| A0A837JT30 | 317-610 | None |
| A0A1J9WPE4 | 501-841 | None |
| A0A7X9FEL8 | 619-831 | None |
| A0A1T5BK16 | 1-226 | None |
| A0A7C1YM30 | 884-1171 | None |
| A0A562V9K7 | 39-278 | None |
| A0A1M4ZFT9 | 165-546 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.