DPCstruct | MC1651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 66 ± 8 aa |
| Standard deviation of domain lengths | 7.80 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 29.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1SWB6 | 6-69 | PRSQSPTNNGSFQDIEKRKVKSDKLMALLTRKFGAGGYEIYTVHDVYSIRAPEKLSQDEIESTP |
| W3X0G7 | 1-57 | MTAQSISNRYIKLEDLRSLLQSKFGAGNFKIREEDESYEIEVPSILSESEIKSIQKY |
| A0A179FUU1 | 453-530 | None |
| A0A6A6W973 | 1-62 | None |
| A0A194XNC7 | 1-66 | None |
| A0A2T6ZLG2 | 43-98 | None |
| A0A6G1JNE4 | 16-95 | None |
| A0A6G1JE13 | 6-69 | None |
| A0A6A6E2U2 | 78-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.