DPCstruct | MC16508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 98 ± 8 aa |
| Standard deviation of domain lengths | 8.24 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11343 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M8KKJ7 | 4-96 | VRFEVTQEATAAVDGARWSCTPELGIHHAATDHAGNIVLTEDHVRGCMERAGSDPHALPRELGIALGEPWDEELEIYRHAGEGVPMR… |
| A0A1F2FB77 | 50-153 | ELDWRGPAGAAARLVGDLARWPDLTFEITEDPDPSIPGAQGERHCHVPALGTWSGTTDAAGDIQVGEQRLRAIVAAHRGDAAGMARA… |
| A0A2W6DXH8 | 157-265 | None |
| A0A6J7VSG8 | 16-107 | None |
| A0A7K1ESS3 | 2-85 | None |
| A0A6J6X0L0 | 11-101 | None |
| Q0RNW6 | 36-128 | None |
| A0A7K1CTK1 | 77-173 | None |
| A4F9W8 | 18-118 | None |
| A0A0R2SIL5 | 33-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.