DPCstruct | MC16507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 83 ± 10 aa |
| Standard deviation of domain lengths | 9.83 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U5SB22 | 2-69 | LEYQAKYAQELAISQRIASAEEVEIEEYYEGEGEGSLGLKAKEGKVALGASGSGRKVTKRVYRFTGFN |
| A0A2C2UZ21 | 1-104 | MEEEAALQEITNFITESQARVTQELAIATRIENAFEVEIEEFYDLSGDGNIGIKANQETGWNVGVGGSGRRIKSRVYRFKGWREGAS… |
| A0A4Q6CFG4 | 36-115 | None |
| A0A7X1U613 | 35-111 | None |
| K0DBL7 | 53-132 | None |
| A0A2Z5MPT3 | 44-137 | None |
| A0A1G6A021 | 48-128 | None |
| A0A427EGU7 | 20-102 | None |
| A0A6B3ZNS1 | 42-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.