DPCstruct | MC16504
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 325 ± 48 aa |
| Standard deviation of domain lengths | 47.97 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z8NCJ2 | 187-403 | QAQDSNEEARTRILGMNSGEKNRVHRNYLGFLQLPEPEQKRLLILHDTLLAAPNTEVLSKVLMTYSRWYQQLDPLEQVEITLRNQHE… |
| A0A523TZA7 | 1-387 | MRSAPVSNRYAKFALLFALIFSTSLLSAADTRGERYRRNLKRWQSLSKKQRLELRQKFEKWRSMSVEERKRIRENHKRFQSLSRKER… |
| A0A7V5AR28 | 8-342 | None |
| A0A5C5ZUC6 | 190-527 | None |
| A0A7W0RPZ5 | 1-350 | None |
| A0A7V3NBS3 | 6-372 | None |
| A0A2E8D239 | 6-291 | None |
| A0A3C0WLN4 | 9-264 | None |
| A0A3L7NCF7 | 189-512 | None |
| A0A286RMF3 | 249-638 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.