DPCstruct | MC16503
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 136 ± 21 aa |
| Standard deviation of domain lengths | 21.21 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G9JKX2 | 46-146 | KVQLMFVQTAEDIQVDPVTKTIRLVNVNKQTLYFSDRPNRIAGNLTMAAYMDEWTARAGKDNFANDPPNATLSVYEPGRQDNTIVVV… |
| A0A523NJU8 | 199-321 | ANAMSLLFVQSSKGISYDSVANTLTLEKVSPVVVFFSDRPYRIAGHVLLARFLELWSEGTDSFKVDPPNASLSIFDTGHVRSAVIEI… |
| D8FC79 | 26-194 | None |
| A0A7G9Z8X0 | 47-197 | None |
| I0Z576 | 20-183 | None |
| A0A1H0LTG8 | 59-208 | None |
| A0A512HR87 | 2-117 | None |
| A0A2M8NWK0 | 18-163 | None |
| A0A7S1YNQ6 | 2-131 | None |
| A0A4S5IZX0 | 4-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.