DPCstruct | MC1650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 228 ± 41 aa |
| Standard deviation of domain lengths | 41.14 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 22.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S3CWX6 | 2-251 | EYLFYNKATVFYWTQSAFNEVGRHGPVILGGIWNAWSNALGREPQMQLDEFFAVPVSVKEEYAKTVRGILRAHESICSQVRKTIEEN… |
| E3RMP0 | 67-309 | MVGDIAKQMCNKPTAFYWLQSAQTGAPDAPEPTCMSGGIFASIYEEWHRSSVNPNIEFGHFFAAPVRITATGPSSLPQILKAHSSLC… |
| A0A842Z7Z0 | 160-421 | None |
| A0A317A498 | 3-202 | None |
| A0A194UNY3 | 6-197 | None |
| A0A2H4SJ83 | 60-273 | None |
| W9KF88 | 51-257 | None |
| A0A6A6Z2A2 | 31-210 | None |
| A0A7D5Z4M8 | 2-180 | None |
| A0A1J7K1R9 | 6-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.