DPCstruct | MC165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 316 ± 24 aa |
| Standard deviation of domain lengths | 23.85 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A290WZ68 | 1-307 | MPAIAIVLVGMAPLAFSQDGRHTAFDTDHAFDAGSRIGLDTVTPVQVDNLAVLGKVWGFLKYHHPLITAGGRQWDYELLRVMPRMLA… |
| A0A1K2III2 | 1-319 | MRKFSLFIIIFLSINFSAQKLSETQKLESLCKVWGFLKYYHPNVAKGNLDWDNQLFQKLNEIEKINDKSQLNEFYSNWIDSLGKVET… |
| A0A1V5R262 | 142-434 | None |
| A0A4Q1F0B3 | 9-289 | None |
| A0A265QBH6 | 1-344 | None |
| A0A520BPM1 | 1-356 | None |
| A0A3D8YE89 | 193-483 | None |
| A0A1C0TQJ6 | 1-327 | None |
| A0A1I0RJI0 | 170-497 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.