DPCstruct | MC16495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 182 ± 9 aa |
| Standard deviation of domain lengths | 9.09 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5ITV2 | 9-190 | CDSLYSKIARAFGMDAMDSEVQVHLKDRLTPIASVPMPARAKALFTRLCDVSHSKKEWVESVASLVAGKPPHLWTDQDVSRFDLESL… |
| A0A6P0S4L1 | 7-171 | REELRIRSQALKGQCVERLLRSFTLAAVDETMTDAEWLEALVMIVADKPAESWTDEDVTRFEIQLADLTRRFKNLEALRAEVAAKGG… |
| A0A7C6THN3 | 57-244 | None |
| A0A6L8FSV9 | 4-182 | None |
| A0A3D4TTW9 | 2-179 | None |
| A0A3C1ZSC2 | 153-327 | None |
| A0A6L7WMJ5 | 461-655 | None |
| A0A381GEL5 | 247-426 | None |
| A0A7K2BKI6 | 347-545 | None |
| A0A1V5PJY4 | 36-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.