DPCstruct | MC16490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Standard deviation of domain lengths | 11.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08888 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3IVJ2 | 3-102 | TFLQVLHDIDTEYLYTPATFYNGLGHAPLVNLAGTNEGSCRVFTYALLVNLDEQQTLQLFAEHYQHVLDHPDGVDHPNVRRFMLDGW… |
| A0A7C1LCX7 | 5-109 | QFVARLSMPEHCFADTLSYIAQHYHYQPSAFDNGSLHNSAEQNQGSCKVLAMAQDLQLTDQQTLACFAEHYQAVLSDPEGSDHANIR… |
| A0A1H1KTJ3 | 268-378 | None |
| A0A4Q5VJF3 | 6-114 | None |
| A0A812HJQ6 | 1-77 | None |
| A0A482YWJ5 | 4-117 | None |
| A0A7Y6YB25 | 285-397 | None |
| K0TQ95 | 466-591 | None |
| A0A7S2XWW1 | 107-232 | None |
| A0A7S2UPK7 | 153-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.