DPCstruct | MC16489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 79 ± 3 aa |
| Standard deviation of domain lengths | 2.86 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 47.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X8EZ84 | 65-144 | ILEEAPLSGVDDALLDEIFGLLVRDFNSYAVELNDKAATTDQQAQFAMRMIRRPAHDAARYDQVWKEHVLPLNGAYEMRP |
| A0A7Y1XGU4 | 8-89 | QLLIENWQKKDIHNDLMDQIFDFMVRDFSKYALQLYSKTSSTRLQQIFGKRMLRKPVVDEQRFNRVLHEFVYAKKGSYTMNP |
| M6GGG6 | 119-196 | None |
| A0A657AFS1 | 114-193 | None |
| A0A7X8YRQ4 | 3-82 | None |
| A0A655FP68 | 65-144 | None |
| N1UC17 | 57-134 | None |
| A0A7Y1VHP4 | 47-128 | None |
| A0A1V5E503 | 1-71 | None |
| A0A534YN34 | 122-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.