DPCstruct | MC16487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 64 ± 7 aa |
| Standard deviation of domain lengths | 7.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 49.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8X0V4 | 16-81 | LQLEVCREFQRSRCTRADSECKYAHPPPHVEIQNGRVIACYDSIKGRCTRENPPCKYFHPPQHLKE |
| A0A096MS04 | 2-66 | ALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSRENC |
| A0A7R9KUJ9 | 31-97 | None |
| A0A1A9XPP3 | 1-59 | None |
| A0A182FU75 | 1-64 | None |
| A0A6P6QUN6 | 41-102 | None |
| A0A6P5VYM3 | 1-68 | None |
| A0A6P5VNJ8 | 6-72 | None |
| T1EHP8 | 1-49 | None |
| A0A3Q0KBT3 | 698-759 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.