DPCstruct | MC16486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 149 ± 14 aa |
| Standard deviation of domain lengths | 14.19 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20047 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R1FBK5 | 1-161 | MRFVFRMKNGRVKTRVYDVDRKTLKKYFEPISKTKAYKQAYFQIYHDQMIMDNLDSVSFTYTNGKETIKRQDSQLYKDFRAAYKQDL… |
| A0A3D8VTG9 | 2-114 | RDEKKSVYETQEYKSIQYPVLALDVSEINQLLMHPYSGQVGKDLYDPEKISAFMEVLKQDLEQLSYDEMVTPKGLDTGVTFTVNGTR… |
| A0A415FF32 | 23-178 | None |
| R6JYQ0 | 261-416 | None |
| R5RBS6 | 58-192 | None |
| A0A7C6YPI4 | 374-524 | None |
| A0A6F9ZK58 | 4-177 | None |
| A0A3B9K675 | 446-592 | None |
| A0A1F8UR61 | 234-395 | None |
| R6FIA5 | 71-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.