DPCstruct | MC16485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 746 ± 102 aa |
| Standard deviation of domain lengths | 101.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 94.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.10 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0694- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R1F1D9 | 2-805 | MTEFKNTESIWTKASESENYAGNQFQGGFLRYDNSSMTPWANSSYRLMGRYPKNIKGDFQKQREFLLSNDIDNSNPVVQAEQLNWMH… |
| A0A1Z2RU78 | 2-581 | YHMKGNPQNANNHLSYNEGYHSGAARMLNKKGNPQLYMDSGEFYSLENVLGRANNRDNISDLVTNSIVNRQNDVTENEATPNWSFVT… |
| A0A0R2JQZ0 | 278-1121 | None |
| A0A139MJP6 | 2-681 | None |
| G5KCZ1 | 76-866 | None |
| A0A0R2E951 | 417-1051 | None |
| A0A1Z2RUC5 | 585-1202 | None |
| A0A143AW57 | 155-875 | None |
| A0A508VS18 | 2-678 | None |
| P29336 | 320-1201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.