DPCstruct | MC1648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 158 ± 18 aa |
| Standard deviation of domain lengths | 18.19 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N4V0J5 | 2-137 | IAISVFGASTFAVIVGEMTDPADIWAPEPPTFTLKTVRLFLAVSWLAFAVSIALAGYSGSFLALMRQKATGEIDDETIRKWTPAGLV… |
| A0A3D8SRV5 | 18-154 | GERLAEYFNNFFATVTAISTLGASITFSKILQTPVAPWIDYGFSDITIQNYIAISWLCFVLDLAITSFAASALSLWRPQAIRYFGTS… |
| A0A0U5GMZ6 | 60-240 | None |
| A0A6A6U544 | 1-165 | None |
| X0H0K9 | 35-180 | None |
| A0A072PCX0 | 6-171 | None |
| A0A4Q4UU11 | 1-200 | None |
| A0A0D2E502 | 10-164 | None |
| A0A6A6DIX0 | 8-160 | None |
| A0A1Y2LVW3 | 30-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.