DPCstruct | MC16479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 329 ± 89 aa |
| Standard deviation of domain lengths | 89.31 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 85.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 22.05 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0004- CL0344- PF02906- PF02256 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U4SZQ7 | 48-449 | DLLKTKDTAICIHCGQCVNVCPTNALVERHDWMDVSDMIKSGKKKIVAITSPSVRVALGEEFGMVAGSYVEKQMVAALRALGVDYVF… |
| A0A177EEB1 | 16-311 | CLACSGCVSVAEPDKEKHERGLQRLLEGGVGLVITPQAKISLFQRVGSFSGFRDFEQALLWVFRKSCVVDSSAGTRALLGQERASLS… |
| A0A2V7S279 | 13-276 | None |
| A0A0A0LVS1 | 166-583 | None |
| A0A7X7IG58 | 70-480 | None |
| A0A1F8UNS4 | 15-362 | None |
| A0A227KCY0 | 73-434 | None |
| A0A3C0BH35 | 1-414 | None |
| L2G8G1 | 51-432 | None |
| A0A1E4BD11 | 11-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.