DPCstruct | MC16478
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 273 ± 21 aa |
| Standard deviation of domain lengths | 20.93 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177ED69 | 179-446 | PAPTEQPSTLPPEPEAVPRTINTDKTIFLFGLCHSKLQTVGVDVNRQILKCQTGDINLFLWCIGTHAPPLIDPGVVFSKLRISGVQP… |
| A0A177EC73 | 103-353 | IPAMPTDAQSPKHHFPPEPEHASRSMASPSQPHTRLDTAALFVQHGSGLDMACIGQSPQIKEKQTGDTHLYLKNLAPEDIPEQIDPA… |
| A0A177EKT1 | 8-286 | None |
| A0A177EJH0 | 67-340 | None |
| A0A177EJ89 | 1-302 | None |
| A0A177EI07 | 1-315 | None |
| A0A177EHI1 | 1-270 | None |
| A0A177EKG6 | 11-282 | None |
| A0A177EET8 | 1-288 | None |
| A0A177EE59 | 16-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.