DPCstruct | MC16477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 171 ± 17 aa |
| Standard deviation of domain lengths | 17.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177EI07 | 1-149 | MGPKTVRYFRKACKKLLGCQLTWLGVFCMAVGCADKVPVPGYITSPYTKQTIKFFKKSGSDGRVNRLEIVEIDGERRLLKKQTQSFT… |
| A0A177EBR3 | 4-201 | NVLMHPFPDTASNRAPVLVQLTQALHQQRIKAILALALLLTSALGALELDTADTEYRLESITIQTLNFFMVSGAKLKTYKVEGGVRL… |
| A0A177ELN1 | 1-165 | None |
| A0A177EKT1 | 9-187 | None |
| A0A177EKG6 | 1-164 | None |
| A0A177EJJ1 | 1-178 | None |
| A0A177EJ89 | 1-205 | None |
| A0A177EGS1 | 3-152 | None |
| A0A177EET8 | 1-166 | None |
| A0A177EE59 | 3-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.