DPCstruct | MC16476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 103 ± 4 aa |
| Standard deviation of domain lengths | 3.93 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 79.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 73.02 |
| Pfam Score | 89.29 |
| Assigned Pfam label(s) | PF20406- CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L9KLL8 | 60-157 | ESKLVKYFSRQLSCKKKVALQERNAELDGFPQLRHWFRIVDVRKEVLEEISPGQLSLEELLEMTDEQVCETVEKYGANREECARLNA… |
| A0A835U096 | 1-101 | MRSKLVKYFSRQLSCKRKVALQERNAKLEGFPQLLHWFRIVDIRKEVMEEIAPGQLSLEDLLDMTDDQVCATVEKFGANSEECARLN… |
| A0A1A6HTI6 | 84-186 | None |
| S9XC76 | 77-182 | None |
| A0A6F9AAA7 | 1-112 | None |
| A0A3B4UZ29 | 58-160 | None |
| A0A4Z2BA91 | 58-160 | None |
| A0A402FU84 | 1-100 | None |
| S4R8K4 | 2-99 | None |
| A0A2U9BV93 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.