DPCstruct | MC16475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 102 ± 8 aa |
| Standard deviation of domain lengths | 7.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A126Q2U2 | 11-102 | NRKGVFRLSFPLNKSTYEDSFGKHPERPLKGEVIKSHFDFTELNLLMPHPVYGWMSWVQILNPSHTNFELLMPKLEVAYSCAQKKFE… |
| A0A7Y5F3Y3 | 35-134 | LPFVTFANSDKDYDNVSHLNREGVFRINIGVSKETFKRLIGERVEPIDYSVLNVFLPHPDYAPQNFICILNPAGENIETTQHLIEEA… |
| A0A4Y9IUI0 | 45-149 | None |
| L9U914 | 83-190 | None |
| A0A561VSI2 | 314-417 | None |
| A0A488ABI0 | 176-264 | None |
| A0A2M9BB69 | 72-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.