DPCstruct | MC16473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 124 ± 13 aa |
| Standard deviation of domain lengths | 12.89 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3BCD3 | 1-132 | MKPIIRDHIFQSSKFFSTPNNEPICDKDNNCIIAETQTVHEKIRIGTTRLYVVYQSSQSQGYSSTLNIQLTPDSIPKSLRFLLLRIL… |
| A0A6I9Q5G0 | 328-446 | RPSPVIVASPLSTFHRCSSEDGPIIPETQVLQEETSIPGSDLNLIYLSSRGAGYKPVLKVTMTQSSIPFNLMKVHLMVAVVGRLFQK… |
| A0A1A8VL89 | 803-949 | None |
| A0A183V5C0 | 570-690 | None |
| A0A5J5D1G1 | 254-381 | None |
| A0A1I8IQV0 | 551-652 | None |
| A0A1U7TNM1 | 374-491 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.