DPCstruct | MC16471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Standard deviation of domain lengths | 8.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03782 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7PG16 | 217-302 | PLAWYFNGQWERKYGSRWSEELCNDWITDDRYLKNFAAEVSQCPCTLEHALADKGRFLPDFDCDKDANPSCFYHKGAVHCVRSGAP |
| A0A1Y3B9S4 | 1-89 | MPLAWYFKKQWEKEYGSNGKWKTYMCNKWFDRETFLDYFATTVFRCPCTMKQAQLDRGHFSPDLQCNVIDRKCDTFHRGALHCVKTG… |
| T1GPA1 | 7-93 | None |
| A0A2G9UUW5 | 422-523 | None |
| A0A811U6I6 | 9-95 | None |
| A0A7R9QUV8 | 1-101 | None |
| A0A2G9TMG0 | 115-221 | None |
| A0A7R8VT11 | 937-1041 | None |
| W2TXK5 | 376-466 | None |
| A0A077ZJX1 | 138-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.