DPCstruct | MC16470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 152 ± 19 aa |
| Standard deviation of domain lengths | 18.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7KM48 | 79-219 | YQALFILLVVLSVELVSEEVLVDLIRLILALQEMGVSNQESLSVLNRCSLHAVCAAALHVLSQLGPPPPLHQHVTQVIESRQKGAPH… |
| A0A1Y3B8Q7 | 3-155 | SDEVLIDLLRLTFALQDMAISRNFNLSDSHRCHIHSIVAGFLHLFSHLKAIPAICTHVEQVIKTRVDKAKYLLPEYCHLANNYNYGE… |
| A0A2B4S862 | 460-640 | None |
| A0A2I0T440 | 80-184 | None |
| A0A0S7KJX7 | 5-154 | None |
| A0A0S7KJX4 | 5-156 | None |
| T1FS07 | 466-626 | None |
| J9BG02 | 9-163 | None |
| A0A818E8F4 | 32-201 | None |
| A0A3P7DC85 | 3-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.