DPCstruct | MC16465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 257 ± 33 aa |
| Standard deviation of domain lengths | 33.45 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 21.44 |
| Pfam Score | 90.67 |
| Assigned Pfam label(s) | PF13874- PF18437- CL0647 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9B8Q8 | 2-200 | PFLTGIDPRLWKQAQEDNPDRDRYVPVPIIGFGELCWRLRCQENETRLHQAFLDKVSDDITELQRRLATTKSKTAEYRRKFVELEHR… |
| A0A1Y3AUW2 | 33-269 | IPDAQLRTNFNQPQCKQQLNQIFIDSFVDTIFTSLSKQEIEAYLSTPPKGIDERIWEQAKLENPDPQRFIPVPLIGFKALNHRFKLQ… |
| A0A182EJD3 | 265-500 | None |
| A0A4Y7TFG6 | 2-233 | None |
| G1Q069 | 1-243 | None |
| A0A1V9ZK41 | 376-632 | None |
| A0A7S3GL62 | 1-253 | None |
| A0A4Y1QPY1 | 2-289 | None |
| A2DR32 | 38-287 | None |
| A0A2U1QB35 | 2-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.