DPCstruct | MC16464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 153 ± 18 aa |
| Standard deviation of domain lengths | 18.31 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6YHC3 | 25-182 | DYDTVRFAYKPVYGLPKSLQCSESVYHKFNECEISSHREWKIWINEYFYETKEFCCFVWQAMACEIEIAAKCNRNYSQQIETSTRKS… |
| A0A1Y3AT43 | 2-142 | NGKYIDDKQQRFQYKPMYGIDQKVNCTKLIRMNFDQCEIQAQNTWDITIDDYFFSEKHFCCFIWTTVDCETQVVNECDEKFGKLLKD… |
| A0A1Y3BI80 | 45-196 | None |
| A0A6P6YJQ6 | 31-147 | None |
| A0A6P6Y8F8 | 19-173 | None |
| A0A6P6Y5P9 | 2-122 | None |
| A0A6P6XXZ2 | 15-161 | None |
| A0A6P6XW06 | 1-140 | None |
| A0A6P6YDY5 | 29-176 | None |
| A0A6P6XV81 | 30-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.