DPCstruct | MC16463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Standard deviation of domain lengths | 6.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14941 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3AT09 | 5-79 | SMFNNHNRQQPCHCSLNIFIPWYVCGVRYCPINNQQQSDQQQQSQNMQRYRCGVRTCRKRYQFNFAVPNHIHCLS |
| A0A3Q0E1K5 | 154-221 | LPRCRQVGDRGKPCVCRYGLSLAWYPCMLKYCHSRDRPAPYKCGIRSCQKSYSFDFYVPQRQLCLWDE |
| Q17F27 | 536-611 | None |
| A0A6I9WSZ0 | 171-250 | None |
| A0A7E4RLN0 | 26-91 | None |
| A0A6P9CTH6 | 135-229 | None |
| A0A4U1F1R0 | 268-351 | None |
| B7PED7 | 23-93 | None |
| A0A6A4VFY1 | 162-232 | None |
| A0A6F9CTH3 | 232-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.