DPCstruct | MC16460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 9.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1I061 | 44-138 | MFNLELRENNLIKEYNVRTEQQPVTISESKAILLVKDMLKTYGYVPRVIEVDHREGNNYVVHAYEIIQDDEKTWHTATIGWYYVDMY… |
| A0A1F6G208 | 40-115 | SETQEILDRVVALPEVQEFIRTLRAAGKVAQFNVEDQGDTWAVQVFEIVTEGANSHTATFDWYEVDKATGAISSMT |
| A0A0L7PLA7 | 107-212 | None |
| A0A0G1S4B2 | 2-88 | None |
| A0A1F5KU88 | 23-109 | None |
| A0A2W4IY12 | 41-137 | None |
| A0A7W2IZF0 | 71-154 | None |
| A0A1F5Z4Y4 | 184-255 | None |
| A0A6M6DVR7 | 244-331 | None |
| A0A398DLJ9 | 13-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.