DPCstruct | MC16459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 69 ± 10 aa |
| Standard deviation of domain lengths | 10.27 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0092 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3HX84 | 318-373 | DGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQ |
| A0A3P8V9N0 | 1-74 | MVSHPEFEHAGKEAGLQVWRVEKMDLVPVPQALHGGFYCGDSYLVLCTKKTGRKMQFDLHYWLGNRIHHVLVLQ |
| F4QBZ5 | 817-874 | None |
| A0A286XKI8 | 1-84 | None |
| A0A068UR05 | 16-75 | None |
| A0A396IGH3 | 15-68 | None |
| K1PYK2 | 138-212 | None |
| A0A4W6FXD7 | 1-71 | None |
| A0A3B5KQ54 | 4-65 | None |
| A0A6D2L945 | 9-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.