DPCstruct | MC16458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 398 ± 58 aa |
| Standard deviation of domain lengths | 58.39 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 20.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7NGG3 | 6-246 | LFYGLQKFVEQSGGHRGGWDEYDHGTFMKVRNKYKGRIVFLDHLKGMLLTKTEDEIREHETWYQEYLFLNERKKDIIKNWRTKREEV… |
| A0A3P8V8R8 | 12-369 | FYYFNFFCMQAYLNCCDKKYLHTYICTWAHHLSFIILFSVIERLTEIMSEVESSINNLKEEQRSWYLYSVNGTKLLDSNLPADVRPL… |
| A0A653CDE7 | 4-346 | None |
| A0A7J6Z1N2 | 53-426 | None |
| A0A401RV61 | 34-474 | None |
| A0A507F7G7 | 86-495 | None |
| A0A834AZN3 | 9-309 | None |
| A0A7M5U7Z6 | 110-571 | None |
| A0A7M5VF12 | 80-529 | None |
| A0A1I8H238 | 23-432 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.