DPCstruct | MC16456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 151 ± 21 aa |
| Standard deviation of domain lengths | 20.69 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V2TYI0 | 301-435 | ESYKGYNLTQSSGKFFAFAPALGGLEPALLSEGDLISWIREGKAFVADTPSELKSKIDDSGFVAEMVLLEEGYKKYNILRYLNQFYG… |
| A0A2H0MRU9 | 1-144 | MSDAPVLIKKFGSYNLIKWKGTFYGLPLSVGPVQMDKGDLSLIPALFQAQTMIEVEKLIVDNRSLIQKHTQPLLEETYGFYNIVVWG… |
| A0A2V8JSZ2 | 123-283 | None |
| A0A1G1N2P7 | 719-861 | None |
| A0A357EGW9 | 1003-1159 | None |
| A0A1Y2K1M5 | 768-927 | None |
| A0A2E6E7Z0 | 210-365 | None |
| A0A525W381 | 278-487 | None |
| A0A522WGC3 | 582-709 | None |
| A0A2H0N0N8 | 514-638 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.