DPCstruct | MC16452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 72 ± 10 aa |
| Standard deviation of domain lengths | 9.65 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 22.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z3HVG9 | 1-61 | MMCVICKQGQTQAGWVTVTLEREGAIVVFKRVPAEICENCGEYYLSDEVTGELLERAEEVM |
| A0A0H3J1T8 | 1-70 | MNCILCKANLVQGKVNHIVDLDGHIIIIKGVPANVCKQCGEYFIENDIALKLEKIIEEVIKNKAEIFVVN |
| A0A7V9UE46 | 8-95 | None |
| A0A317MZ46 | 3-64 | None |
| A0A1J5NDF9 | 1-73 | None |
| A0A162LAN4 | 40-109 | None |
| A0A2N3BTQ8 | 25-84 | None |
| A0A1M6SA68 | 63-120 | None |
| A0A7X3RB11 | 37-101 | None |
| I4DCS7 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.