DPCstruct | MC16447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 105 ± 16 aa |
| Standard deviation of domain lengths | 16.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 35.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10905 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M9AH33 | 7-108 | PVDHECLACFLYRALRAQGCDGTHLFLLAYRDESAPRATAVERKMQLLGGYCDCEVLANAIRPITREASNALEDEVDLVCKGVRRGT… |
| A0A1G6LXF1 | 18-123 | VALTAPEPAEGVLCYAERMLTGFGCDGTLRWARRWRDLRVPRATGQERRLGSRGGHCDCEVFLNGWTLREDLWVDDEDGAPTWPAER… |
| A0A4R9BSW6 | 39-174 | None |
| A0A5N0THE5 | 8-108 | None |
| W9GSP9 | 19-122 | None |
| A0A7X0VAK1 | 1-90 | None |
| A0A2S3ZS95 | 17-133 | None |
| A0A522BVD0 | 85-186 | None |
| C6L1H4 | 220-338 | None |
| A0A2S8WUV6 | 3-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.