DPCstruct | MC16445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 125 ± 16 aa |
| Standard deviation of domain lengths | 16.04 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.43 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0031- PF11127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6K427 | 12-90 | GAPGFAAAGGDVVRGAPRWDLERQVRLAAGTLVLTGLAAGRFVSPRLRVLAGAVGAGLSFSAATNICAMGKALARMPWN |
| A0A2T5AN93 | 4-136 | PLLAEHGEEFASRLPGQVVLICQSGNRARQANERLEAVGADPDSVTVLDGGIAAFESAGGEVIRGKGVWAMDRQVRMAAGSLVLAGV… |
| A0A2D6TR87 | 42-166 | None |
| A0A4Q2I049 | 2-115 | None |
| A0A2M6X357 | 36-163 | None |
| F8L3N9 | 43-174 | None |
| A0A3D1F212 | 42-180 | None |
| A0A1F9QHX4 | 28-162 | None |
| A0A7V5UJW4 | 16-140 | None |
| A0A1F7RUR7 | 266-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.