DPCstruct | MC16440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 663 ± 95 aa |
| Standard deviation of domain lengths | 95.27 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 63.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V6KZW1 | 83-629 | KAYKDKRYSGFTGKLKWGKDKLLGMPEEANALFAKSRKLYVTRMQQVISSIADTIGAELGKAKTRIARGRRQMKTEVDKLPQDLRAL… |
| A0A1L6L537 | 97-757 | DKFKDDRYSGIIGKGRWLADLFRPAPEGIKQILRQARTRFAAEMDALAVEISSSVDRRLKEAKDEVARGQKRIDQYVKSLPKNLQSV… |
| A0A3A8NFF7 | 1-805 | None |
| A0A284VRP8 | 204-737 | None |
| A0A0M9DRW0 | 384-1085 | None |
| A0A2D3UHL0 | 2-717 | None |
| A0A160NSF4 | 8-547 | None |
| A0A429ETM9 | 216-847 | None |
| R1G201 | 208-1088 | None |
| A0A1G7TEZ8 | 328-1020 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.