DPCstruct | MC16438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 103 ± 11 aa |
| Standard deviation of domain lengths | 10.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L6L4X5 | 65-173 | PTPETSAPAKQSPAKPERRCGWVDNPTPANWWLTDRDGTWDIGIQGGYQAKGDLPDFGAKWVETNGHHGYGCACMDVEVDRAAKRVI… |
| A0A1C2DZ29 | 2-95 | ENRCGWLANPTPGNWWLTDKDATWVLAAQGGAEATGMDKLPDFNPKQYVKSNGNYGYGCACVKLTTDPATKTVKSVTGGKTLPLVTC… |
| A0A6P2VTC7 | 19-137 | None |
| A0A5B7QZS0 | 339-455 | None |
| N1U6R8 | 38-147 | None |
| A0A4Q6DL99 | 40-145 | None |
| A0A4Q6EXH1 | 9-112 | None |
| A0A838GYD4 | 11-106 | None |
| A0A6S7CUJ0 | 10-106 | None |
| A0A845YA62 | 101-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.