DPCstruct | MC16434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 229 ± 30 aa |
| Standard deviation of domain lengths | 30.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812V336 | 230-471 | AMFARLCGSGLGSTRISFPGRINVRSGRCIVSFPGKYSKEWDQAVWATTNDKTWATNPDNVCSLACVFLTQRKSGLGQHAKRTEFPG… |
| A0A812LUW4 | 745-966 | KRIAFPGRISERSKDCVVSFPGKYSHEWDAAVSAASKQQDDMSLACVFLTDRASGLGLHADNPDTPGKCWCHAIYGRMAAKDYVSKV… |
| A0A1Q9CBD6 | 429-664 | None |
| A0A813AF97 | 91-267 | None |
| A0A1Q9BYR2 | 550-798 | None |
| A0A1Q9C184 | 362-644 | None |
| A0A1Q9C2B7 | 348-588 | None |
| A0A812KDJ3 | 10-250 | None |
| A0A812L1N4 | 608-845 | None |
| A0A812KLS3 | 242-441 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.