DPCstruct | MC16433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 140 ± 25 aa |
| Standard deviation of domain lengths | 25.02 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09371 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B1KXK3 | 5-151 | IEGRIAEELGVHERQVKAAVDLLDGGSTVPFIARYRKEATEMLDDAQLRTLEERLRYLRELEDRRAAVLDSVREQGKLDEALEAQIR… |
| A0A812UU76 | 91-226 | DLAGWVSQQVSLDRGYVENALQLLQEGTSVHFIAFYRKELTGCMTEEALHFVEREMKRGLALEQRRRHMALELQRRGQLTPERQMQL… |
| A0A812ISK1 | 18-158 | None |
| A0A7R8X3H9 | 206-314 | None |
| A0A821X720 | 387-536 | None |
| A0A6D2JBP6 | 199-475 | None |
| A0A377D8P2 | 6-152 | None |
| A0A1G8IBK4 | 18-164 | None |
| A0A3Q0IV34 | 234-383 | None |
| A0A3R8P6K4 | 3-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.