DPCstruct | MC16432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 171 ± 15 aa |
| Standard deviation of domain lengths | 15.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N4LCK1 | 31-195 | MRIKEDGTLIVDPLELINCSQYGNAARNSDPMIGARINKLARKGNSVSIKDPVAIYMQKFDTSTLVLVKSEENQVPLPDGVITWVRG… |
| A0A1Y1IQJ7 | 290-454 | MHLIQDSNSLSAEIELAGGSSIVRTSDGQILEDSQDLIQCGQYGAPGRNSDPHIGSEVNALARANAFLTLKNPVALYIDGLDASTWT… |
| A0A1M7KI46 | 239-419 | None |
| F8CM33 | 218-379 | None |
| A0A7W0FXS0 | 377-563 | None |
| A0A0G2FLY8 | 61-261 | None |
| V7GVR5 | 182-366 | None |
| A4YMN2 | 278-442 | None |
| A0A2U8QRS8 | 11-163 | None |
| A0A849TB37 | 152-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.