DPCstruct | MC1643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 125 ± 14 aa |
| Standard deviation of domain lengths | 14.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 65.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 42.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W8D9B7 | 2-128 | PPVPPESRGDDGSAPSTSPSDTVPCTYCVGVSVYTKAMWRERRTPDCKGIQVDFNSSRERLQEMRDRAEPSTKQFRINYGKLHAAHP… |
| A0A4D8YM43 | 15-139 | KPKIPNTDDFTTKKTNHGEASVSGSGANKGRSCKGCLYYSSQFKSDSRNPLCLGLSRSLPNAPRYIVGTSEMEASKEGMILRDFKYG… |
| A0A6P6T4F0 | 45-178 | None |
| A0A834ZIR5 | 1-129 | None |
| A0A4S4E010 | 2-99 | None |
| A0A3Q0ERQ1 | 37-157 | None |
| A0A6D2I2B1 | 1-134 | None |
| Q0D9J0 | 11-129 | None |
| A0A5J5ALI4 | 4-134 | None |
| A0A3L6S0A3 | 79-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.