DPCstruct | MC16419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 234 ± 63 aa |
| Standard deviation of domain lengths | 62.54 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 72.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L7JU64 | 1-162 | MAQPLNLWMPLEITEVLNFVPMEEFLTNFSLQVDKQLCNNIFVRPPEKIPEIKDFTANNTVIKIINNAILKLLVSDSQNILSLGYAR… |
| A0A2P4T606 | 15-209 | RGVAREEPFAAILGALRGCYAEATPLEAFVRRLQEGGTGEVEVLRGDDAQCYRTFVSQCVVCVPRGARAIPRPICFQQLSSQSEVIT… |
| A0A370PDY4 | 2-282 | None |
| A0A6A4PHA0 | 1-211 | None |
| A0A2G8LK68 | 1-163 | None |
| A0A4S9JN40 | 2-254 | None |
| A0A2T6ZJB7 | 79-284 | None |
| H3ADV1 | 3-185 | None |
| A0A433DHN2 | 5-185 | None |
| A0A418B0L8 | 2-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.